Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2J1 (OR2J1)

This Recombinant Human Olfactory receptor 2J1 (OR2J1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2J1, Hs6M1-4, Olfactory receptor 6-5, OR6-5

UniProt

Q9GZK6

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMKKNASFEDFFLLLGFSNWPHLEVVLFVVILIFYLITLIGNLFIIILSYLDSHLHTPM YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCTVQLYFVLALGTAECVLLVVMS YDRYAAVCRPLHYTVLMHPRFCRLLAAASWVSGFTTSALHSSFTFWIPLCRHRLVDHFFC EVPALLRLSCVDTQANELTLMVMSSIFVLIPLILILTSYGAIARAVLSMQSTTGLQKVLR TCGAHLMVVSLFFIPVMCMYLQPPSENSQDQGKFIALFYTVVTPSLNPLIYTFRNKDVRG AVKRLMGWEWGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Tuberculosis vapC13 Protein (aa 1-131)
VAng-Yyj0355-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis vapC13 Protein (aa 1-131)

Sign In for Pricing
View Details
Econazole Nitrate (powder)
50R-R14827 50 mg

Econazole Nitrate (powder)

Sign In for Pricing
View Details
Trib3 ORF Vector (Mouse) (pORF)
ORF060345 1.0 µg DNA

Trib3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal PAG1 Antibody (MEM-255) [PE/Cy5.5]
NB500-342PECY55 0.1 mL

Mouse Monoclonal PAG1 Antibody (MEM-255) [PE/Cy5.5]

Sign In for Pricing
View Details
Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)
32-7787-10 10 µg

Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)

Sign In for Pricing
View Details
BTN2A1 Rabbit Polyclonal Antibody
orb579886 100 µL

BTN2A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details