Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52A1 (OR52A1)

This Recombinant Human Olfactory receptor 52A1 (OR52A1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 52A1, HPFH1OR, Odorant receptor HOR3'beta4, Olfactory receptor OR11-319

UniProt

Q9UKL2

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEP LYIFLGMLGATDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAM ALDRYVAICYPLRHANIFTHQLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHS YCEHMAIVKLAAANVQVNKIYGLFVAFTVAGFDLTFITLSYIQIFITVFRLPQKEARFKA FNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTT QIRIHVVKMFCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytidine Monophosphate Kinase 1 Human Recombinant
rAP-1660 1 Each

Cytidine Monophosphate Kinase 1 Human Recombinant

Sign In for Pricing
View Details
Reelin (RELN) Antibody
abx100021-01 100 µL

Reelin (RELN) Antibody

Sign In for Pricing
View Details
Reelin (RELN) Antibody
abx100021-02 200 µL

Reelin (RELN) Antibody

Sign In for Pricing
View Details
Reelin (RELN) Antibody
abx100021-03 1 mL

Reelin (RELN) Antibody

Sign In for Pricing
View Details
HRH1 Protein Lysate (Mouse) with C-HA Tag
23898034 100 µg

HRH1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Monoclonal CHIP/STUB1 Antibody (034) [mFluor Violet 610 SE]
NBP2-90116MFV610 0.1 mL

Rabbit Monoclonal CHIP/STUB1 Antibody (034) [mFluor Violet 610 SE]

Sign In for Pricing
View Details