Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52A1 (OR52A1)

This Recombinant Human Olfactory receptor 52A1 (OR52A1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 52A1, HPFH1OR, Odorant receptor HOR3'beta4, Olfactory receptor OR11-319

UniProt

Q9UKL2

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEP LYIFLGMLGATDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAM ALDRYVAICYPLRHANIFTHQLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHS YCEHMAIVKLAAANVQVNKIYGLFVAFTVAGFDLTFITLSYIQIFITVFRLPQKEARFKA FNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTT QIRIHVVKMFCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (HRP)
MBS6440448-01 0.1 mL

TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (HRP)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (HRP)
MBS6440448-02 5x 0.1 mL

TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (HRP)

Sign In for Pricing
View Details
Mouse Cth / Cystathionine gamma-lyase Recombinant Protein
R1538m 1 Each

Mouse Cth / Cystathionine gamma-lyase Recombinant Protein

Sign In for Pricing
View Details
Cysteine-rich secretory protein 1 (CRISP1) Monkey ELISA Kit
C7328 96 Tests

Cysteine-rich secretory protein 1 (CRISP1) Monkey ELISA Kit

Sign In for Pricing
View Details
GPX7 (Glutathione Peroxidase 7, Glutathione Peroxidase RuleBase RU000499)
482211 100 µL

GPX7 (Glutathione Peroxidase 7, Glutathione Peroxidase RuleBase RU000499)

Sign In for Pricing
View Details
Human ASGR1 ELISA Matched Antibody Pair Set [ABP-Q-04-29]
ABP-Q-04-29 5 Plates

Human ASGR1 ELISA Matched Antibody Pair Set [ABP-Q-04-29]

Sign In for Pricing
View Details