Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1D2 (OR1D2)

This Recombinant Human Olfactory receptor 1D2 (OR1D2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D2, Olfactory receptor 17-4, OR17-4, Olfactory receptor OR17-6, Olfactory receptor-like protein HGMP07E

UniProt

P34982

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVY FFLANLSFTDLFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAY DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCE MYVLLRMACSNIQINHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSVSKKYKAFST CASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL GRLLDKHFKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)
TRV-0042925-01 20 µL

Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)
TRV-0042925-02 100 µL

Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)
TRV-0042925-03 200 µL

Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)
TRV-0042925-04 1 mL

Polyclonal Antibody to Membrane Protein, Palmitoylated 2 (MPP2)

Sign In for Pricing
View Details
DEPDC7 (LOC91614, DEP Domain-containing Protein 7, Protein TR2/D15, DJ85M6.4) (HRP)
MBS6153343-01 0.1 mL

DEPDC7 (LOC91614, DEP Domain-containing Protein 7, Protein TR2/D15, DJ85M6.4) (HRP)

Sign In for Pricing
View Details
DEPDC7 (LOC91614, DEP Domain-containing Protein 7, Protein TR2/D15, DJ85M6.4) (HRP)
MBS6153343-02 5x 0.1 mL

DEPDC7 (LOC91614, DEP Domain-containing Protein 7, Protein TR2/D15, DJ85M6.4) (HRP)

Sign In for Pricing
View Details