Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M5 (OR2M5)

This Recombinant Human Olfactory receptor 2M5 (OR2M5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2M5

UniProt

A3KFT3

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY FLLSQLFLMDLMLICSTVPKMAFNYLSGSKSISMAGCATQIFFYVSLLGSECFLLAVMSY DRYIAICHPLRYTNLMRPKICGLMTAFSWILGSMDAIIDAVATFSFSYCGSREIAHFFCD FPSLLILSCNDTSIFEKVLFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT CSSHLMVVGMYYGAGLFMYIRPTSDRSPMQDKLVSVFYTILTPMLNPLIYSLRNKEVTRA LRKVLGKGKCGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shisa7 Mouse Gene Knockout Kit (CRISPR)
KN515755 1 Kit

Shisa7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS711753 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Poly-L-arginine Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW13F4-AR 10x 96 Well Plates

Poly-L-arginine Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
GPR137C (NM_001099652) Human Over-expression Lysate
LY420474 100 µg

GPR137C (NM_001099652) Human Over-expression Lysate

Sign In for Pricing
View Details
Accuris High Fidelity Master Mix, 500 rxns
PR1001-HF-500 1 Each

Accuris High Fidelity Master Mix, 500 rxns

Sign In for Pricing
View Details
PRR25 (NM_001013638) Human Over-expression Lysate
LC422996 20 µg

PRR25 (NM_001013638) Human Over-expression Lysate

Sign In for Pricing
View Details