Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C74 (OR6C74)

This Recombinant Human Olfactory receptor 6C74 (OR6C74) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C74

UniProt

A6NCV1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNHTTVANFILLGLTDDPQLQVIIFLLLFFTYMLSITGNLTIITLTLLDLHLKTPMYFF LRNFSFLEVSFTTVYIPKFLVSMATGDKTISYNDCAAQLFFTILLGATEFFLLAAMSYER YVAICKPLHYTTIMSSRVCSLLVFASWMAGFLIIFPPLLMGLQLDFCAANTVDHFFCDVS PILQLSCTDTDIIELMMLLSAILTLLVTLVLVILSYTNIIRTILKIPSSQQRKKAFSTCS SHMVVVSISYGSCIFMYVKPSAKERVSLNKGIALLSTSVAPMLNPFIYTLRNKQVKDVFK HTVKKIELFSMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neuropilin-1/NRP1/CD304 Monoclonal Antibody
AN300099P 100 µL

Recombinant Neuropilin-1/NRP1/CD304 Monoclonal Antibody

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9726-01 50 μL

LAMP3 Antibody

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9726-02 100 µL

LAMP3 Antibody

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9726-03 1 mL

LAMP3 Antibody

Sign In for Pricing
View Details
SmartSeal™ Semi-Automated Microplate Sealer, 230V
MS1000-E 1 Each

SmartSeal™ Semi-Automated Microplate Sealer, 230V

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS801336 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details