Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C74 (OR6C74)

This Recombinant Human Olfactory receptor 6C74 (OR6C74) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C74

UniProt

A6NCV1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNHTTVANFILLGLTDDPQLQVIIFLLLFFTYMLSITGNLTIITLTLLDLHLKTPMYFF LRNFSFLEVSFTTVYIPKFLVSMATGDKTISYNDCAAQLFFTILLGATEFFLLAAMSYER YVAICKPLHYTTIMSSRVCSLLVFASWMAGFLIIFPPLLMGLQLDFCAANTVDHFFCDVS PILQLSCTDTDIIELMMLLSAILTLLVTLVLVILSYTNIIRTILKIPSSQQRKKAFSTCS SHMVVVSISYGSCIFMYVKPSAKERVSLNKGIALLSTSVAPMLNPFIYTLRNKQVKDVFK HTVKKIELFSMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA506925AM 100 µL

MADCAM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (rNF421), 1mg/mL
BNUM2348-50 1x 50 µL

Neurofilament (NF-H) (Neuronal Marker) (rNF421), 1mg/mL

Sign In for Pricing
View Details
CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: O10+C1A/711]
AM50211PU-S 100 µg

CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: O10+C1A/711]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501861 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ReadiUse™ microscope mounting solution
20009-AAT 50 mL

ReadiUse™ microscope mounting solution

Sign In for Pricing
View Details
Tet1 Mouse Gene Knockout Kit (CRISPR)
KN517422 1 Kit

Tet1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details