Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C68 (OR6C68)

This Recombinant Human Olfactory receptor 6C68 (OR6C68) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C68

UniProt

A6NDL8

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIALTMLDPHLKTPMYFF LQNLSFLEISFTATCVPRFLYSISTGNKIITYNACVIQLFFADLFGVTEFFLLATMSYDR YVAICKPLHYMAIMSNKVCKTMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDAL PILKIPCSDTSLIEQMVVASAVLTFIITLVCVVLSYTYIIRTILKFPSVQQKKKAFSTCS SHITVVSITYGSCIFIYIKPSAKEEVNINKGVSVLISSISPMLNSFIYTLRNEQVKQAFH DSLKKIAFRLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG2 (Voltage-dependent Calcium Channel gamma-2 Subunit, MRD10) discontinued
347651-01 100 µL

CACNG2 (Voltage-dependent Calcium Channel gamma-2 Subunit, MRD10) discontinued

Sign In for Pricing
View Details
CACNG2 (Voltage-dependent Calcium Channel gamma-2 Subunit, MRD10) discontinued
347651-02 200 µL

CACNG2 (Voltage-dependent Calcium Channel gamma-2 Subunit, MRD10) discontinued

Sign In for Pricing
View Details
Annexin A5 (ANXA5) Mouse ELISA Kit
B5339 96 Tests

Annexin A5 (ANXA5) Mouse ELISA Kit

Sign In for Pricing
View Details
Histone H3 Ser28 Rabbit Polyclonal Antibody
E53P04418 100 µL

Histone H3 Ser28 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VDAC2 (Voltage-dependent Anion-selective Channel Protein 2, VDAC-2, hVDAC2, Outer Mitochondrial Membrane Protein Porin 2, POR, FLJ23841) discontinued
151135 100 µg

VDAC2 (Voltage-dependent Anion-selective Channel Protein 2, VDAC-2, hVDAC2, Outer Mitochondrial Membrane Protein Porin 2, POR, FLJ23841) discontinued

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 2 (CXCL2) CLIA Kit
abx492902-01 96 Tests

Mouse C-X-C Motif Chemokine 2 (CXCL2) CLIA Kit

Sign In for Pricing
View Details