Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T8 (OR2T8)

This Recombinant Human Olfactory receptor 2T8 (OR2T8) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2T8

UniProt

A6NH00

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENGSYTSYFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL LSQLSLMDVMLVSTTVPKMAADYLTGSKAISRAGCGAQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMNLSCWLLGAADGLLQAVATLSFPYCGAHEIDHFFCETP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALT RCMGRCVALSRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-LHFPL3-AS1 Plasmid
PVT28845 2 µg

pOTB7-LHFPL3-AS1 Plasmid

Sign In for Pricing
View Details
Rplp0 (NM_007475) Mouse Untagged Clone
MC200491 10 µg

Rplp0 (NM_007475) Mouse Untagged Clone

Sign In for Pricing
View Details
Phospho-NF-κB p65 (Ser536) Rabbit mAb
F0155-100uL*2 2x 100 μL

Phospho-NF-κB p65 (Ser536) Rabbit mAb

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni acpP Protein (strain RM1221) (aa 1-77)
VAng-Lsx6187-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni acpP Protein (strain RM1221) (aa 1-77)

Sign In for Pricing
View Details
C10orf140 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9776R-BF405 100 µL

C10orf140 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Prepro-Intermedin (57-92) / prepro-Adrenomedullin-2 (57-92) (Human)
010-62 100 µg

Prepro-Intermedin (57-92) / prepro-Adrenomedullin-2 (57-92) (Human)

Sign In for Pricing
View Details