Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T8 (OR2T8)

This Recombinant Human Olfactory receptor 2T8 (OR2T8) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2T8

UniProt

A6NH00

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENGSYTSYFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL LSQLSLMDVMLVSTTVPKMAADYLTGSKAISRAGCGAQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMNLSCWLLGAADGLLQAVATLSFPYCGAHEIDHFFCETP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALT RCMGRCVALSRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Acetamido-6-chloro-9- (2'',3'',5''-tri-O-acetyl-b-D-ribofuranosyl) purine
GN8510-1g 1 g

2-Acetamido-6-chloro-9- (2'',3'',5''-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
Gold/Germanium 88/12 wt% Granules max. 3 mm, 99.99% (metals basis)
GX3779-1g 1 g

Gold/Germanium 88/12 wt% Granules max. 3 mm, 99.99% (metals basis)

Sign In for Pricing
View Details
TWSG1 Recombinant Protein
OPCD07772-50UG 50 µg

TWSG1 Recombinant Protein

Sign In for Pricing
View Details
MGAT3 3'UTR Luciferase Stable Cell Line
TU013316 1.0 mL

MGAT3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
XCR1 Mouse Monoclonal Antibody
orb2958969-01 50 µg

XCR1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
XCR1 Mouse Monoclonal Antibody
orb2958969-02 100 µg

XCR1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details