Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T8 (OR2T8)

This Recombinant Human Olfactory receptor 2T8 (OR2T8) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2T8

UniProt

A6NH00

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENGSYTSYFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL LSQLSLMDVMLVSTTVPKMAADYLTGSKAISRAGCGAQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMNLSCWLLGAADGLLQAVATLSFPYCGAHEIDHFFCETP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALT RCMGRCVALSRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Histone H3 Antibody (1B1-B2) [DyLight 405]
NBP2-36468V 0.1 mL

Mouse Monoclonal Histone H3 Antibody (1B1-B2) [DyLight 405]

Sign In for Pricing
View Details
CENPA Antibody : Biotin (OAAF02892-Biotin)
OAAF02892-100UG-Biotin 100 µg

CENPA Antibody : Biotin (OAAF02892-Biotin)

Sign In for Pricing
View Details
SLMAP Rabbit Polyclonal Antibody (Fluoro550)
orb3100480 100 µg

SLMAP Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
PIK3C3 Antibody (Phospho-S164)
OAAB01786-400UL 400 µL

PIK3C3 Antibody (Phospho-S164)

Sign In for Pricing
View Details
MAP7 rabbit pAb
E44H13525 100 µL

MAP7 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Phospho-Tyrosine Antibody (SPM102) [Janelia Fluor 646]
NBP3-11616JF646 0.1 mL

Mouse Monoclonal Phospho-Tyrosine Antibody (SPM102) [Janelia Fluor 646]

Sign In for Pricing
View Details