Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C65 (OR6C65)

This Recombinant Human Olfactory receptor 6C65 (OR6C65) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C65

UniProt

A6NJZ3

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNMTSIREFILLGFTDNPELQVVIFFFMLITYLLSVSGNMIIIMLTLSNIHLKTPMYFF LRNFSFLEISFTTVFIPRFLINIATGDTTISYNASMAQVFFLILLGSTEFFLLAVMSYDR YVAICKPLHYTTIMSNKVCNWLVISSWLAGFLIIFPPVIMGLQLDFCDSSTIDHFICDSS PMLLIACTDTQFLELMAFLLAVFTLMVTLALVVLSYTLILKTILKIPSAQQRKKAFSTCS SHMIVVSVSYGSCIFMCVKTSAKEGMALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALR EFTKKILSLNKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULT2A1 (N-term) Rabbit Polyclonal Antibody
AP54105PU-N 400 µL

SULT2A1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trimellitic Anhydride
TRC-T795865-250G 250 g

Trimellitic Anhydride

Sign In for Pricing
View Details
(1R,2R,3S)-Ticagrelor
TRC-T437685-10MG 10 mg

(1R,2R,3S)-Ticagrelor

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP1) (rRBP1/872), Biotin conjugate, 0.1mg/mL
BNCB3603-100 1x 100 µL

Retinol Binding Protein-1 (RBP1) (rRBP1/872), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triisopropyl Borate
TRC-T795490-25G 25 g

Triisopropyl Borate

Sign In for Pricing
View Details
INTS10 Rabbit Polyclonal Antibody
TA377532 100 µL

INTS10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details