Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C65 (OR6C65)

This Recombinant Human Olfactory receptor 6C65 (OR6C65) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C65

UniProt

A6NJZ3

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNMTSIREFILLGFTDNPELQVVIFFFMLITYLLSVSGNMIIIMLTLSNIHLKTPMYFF LRNFSFLEISFTTVFIPRFLINIATGDTTISYNASMAQVFFLILLGSTEFFLLAVMSYDR YVAICKPLHYTTIMSNKVCNWLVISSWLAGFLIIFPPVIMGLQLDFCDSSTIDHFICDSS PMLLIACTDTQFLELMAFLLAVFTLMVTLALVVLSYTLILKTILKIPSAQQRKKAFSTCS SHMIVVSVSYGSCIFMCVKTSAKEGMALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALR EFTKKILSLNKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL
BNC743298-500 1x 500 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLT3 Human Gene Knockout Kit (CRISPR)
KN211459LP 1 Kit

FLT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Indolicidin TFA Salt
TRC-I627273-1MG 1 mg

Indolicidin TFA Salt

Sign In for Pricing
View Details
Human SIRT5 activation kit by CRISPRa
GA108286 1 Kit

Human SIRT5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant DRP1 Monoclonal Antibody
AN301080L-01 50 µL

Recombinant DRP1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant DRP1 Monoclonal Antibody
AN301080L-02 100 µL

Recombinant DRP1 Monoclonal Antibody

Sign In for Pricing
View Details