Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C70 (OR6C70)

This Recombinant Human Olfactory receptor 6C70 (OR6C70) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C70

UniProt

A6NIJ9

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFF LRNFSFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDR YVAICKPLRYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDIS LILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCS SHMIVVSITYGSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK AVFRKIFSASDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetoxy Ticagrelor Acetonide
TRC-A445310-5MG 5 mg

Acetoxy Ticagrelor Acetonide

Sign In for Pricing
View Details
p53 (TP53) pSer46 Rabbit Polyclonal Antibody
AP01659PU-N 100 µg

p53 (TP53) pSer46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS713605 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]
AM31187AF-N 200 µg

ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504259 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
KTI3 Rabbit Polyclonal Antibody
TA397063S 25 µL

KTI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details