Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C70 (OR6C70)

This Recombinant Human Olfactory receptor 6C70 (OR6C70) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C70

UniProt

A6NIJ9

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFF LRNFSFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDR YVAICKPLRYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDIS LILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCS SHMIVVSITYGSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK AVFRKIFSASDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclododecanone
TRC-C989955-5G 5 g

Cyclododecanone

Sign In for Pricing
View Details
Pure Rat IgG Gel Immuno Absorbant Immobilized Antibodies
AG-032-2 2 mL

Pure Rat IgG Gel Immuno Absorbant Immobilized Antibodies

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF640R conjugate, 0.1mg/mL
BNC401812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kv2.1 (KCNB1) Mouse Monoclonal Antibody [Clone ID: K39/25]
75-159 100 µL

Kv2.1 (KCNB1) Mouse Monoclonal Antibody [Clone ID: K39/25]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB500860 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
Human TBC1D24 activation kit by CRISPRa
GA111510 1 Kit

Human TBC1D24 activation kit by CRISPRa

Sign In for Pricing
View Details