Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C76 (OR6C76)

This Recombinant Human Olfactory receptor 6C76 (OR6C76) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C76

UniProt

A6NM76

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFF LRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCY VAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAP LLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSS HVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD VLRKISHKKKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SULT1B1 activation kit by CRISPRa
GA109094 1 Kit

Human SULT1B1 activation kit by CRISPRa

Sign In for Pricing
View Details
QuantiFluo™ Angiotensin-Converting Enzyme 1 Assay Kit
QACE1-100 100 Tests

QuantiFluo™ Angiotensin-Converting Enzyme 1 Assay Kit

Sign In for Pricing
View Details
Ugt2b38 Mouse Gene Knockout Kit (CRISPR)
KN518679 1 Kit

Ugt2b38 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HM74 (HCAR3) Rabbit Polyclonal Antibody
TA376950 100 µL

HM74 (HCAR3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Brentuximab Biosimilar - Research Grade
ICH5137-50mg 50 mg

Brentuximab Biosimilar - Research Grade

Sign In for Pricing
View Details
Hsp90 beta Recombinant Rabbit Monoclonal Antibody [SY46-01]
ET1605-56 100 µL

Hsp90 beta Recombinant Rabbit Monoclonal Antibody [SY46-01]

Sign In for Pricing
View Details