Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C76 (OR6C76)

This Recombinant Human Olfactory receptor 6C76 (OR6C76) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C76

UniProt

A6NM76

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFF LRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCY VAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAP LLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSS HVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD VLRKISHKKKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC1 (SMC1A) pSer957 Rabbit Polyclonal Antibody
AP01685PU-N 100 µg

SMC1 (SMC1A) pSer957 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL
BNC682007-100 1x 100 µL

MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA379156 100 µL

CARD12 (NLRC4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034D-01 50 Tests

PE Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
PE Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034D-02 100 Tests

PE Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
PE Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034D-03 2x 100 Tests

PE Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details