Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F21 (OR4F21)

This Recombinant Human Olfactory receptor 4F21 (OR4F21) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F21

UniProt

O95013

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNIFIVFSVTTDPHLHSPMY FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR VCKQLVIYKKIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmf1 (NM_212446) Mouse Tagged Lenti ORF Clone
MR218495L3 10 µg

Psmf1 (NM_212446) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDRT15P CRISPR Knock Out 293T Cell Line (Human)
55290141 1x 10^6 Cells / 1.0 mL

CDRT15P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-Ezrin Antibody
CPA2226-01 30 µL

Anti-Ezrin Antibody

Sign In for Pricing
View Details
Anti-Ezrin Antibody
CPA2226-02 50 μL

Anti-Ezrin Antibody

Sign In for Pricing
View Details
Anti-Ezrin Antibody
CPA2226-03 100 µL

Anti-Ezrin Antibody

Sign In for Pricing
View Details
Anti-Ezrin Antibody
CPA2226-04 200 µL

Anti-Ezrin Antibody

Sign In for Pricing
View Details