Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2H2 (OR2H2)

This Recombinant Human Olfactory receptor 2H2 (OR2H2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2H2, Hs6M1-12, Olfactory receptor 2H3, Olfactory receptor-like protein FAT11

UniProt

O95918

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFF LSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDR YVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVP ALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCS SHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFR RLLGKEMGLTQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Merlin Recombinant Rabbit monoclonal Antibody
HA750815 100 µL

Merlin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Satl1 Mouse Gene Knockout Kit (CRISPR)
KN515312 1 Kit

Satl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP7B (NM_000053) Human Over-expression Lysate
LY424958 100 µg

ATP7B (NM_000053) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (L452R, E484Q) (His Tag)
PKSV030336 100 µg

Recombinant SARS-CoV-2 Spike RBD (L452R, E484Q) (His Tag)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]
E-AB-F1056M-01 20 Tests

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]
E-AB-F1056M-02 100 Tests

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details