Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2C1 (OR2C1)

This Recombinant Human Olfactory receptor 2C1 (OR2C1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2C1, OLFmf3, Olfactory receptor 2C2, Olfactory receptor OR16-1, Olfactory receptor OR16-2

UniProt

O95371

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMY FFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAF DRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCE VPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNT CLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA LRRLLGKGREVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase/TYMS Rabbit Polyclonal Antibody (Cy3)
orb2591726 100 µg

Thymidylate Synthase/TYMS Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ULK3, NT (Serine/Threonine-protein Kinase ULK3, Unc-51-like Kinase 3) (MaxLight 550) discontinued
U1500-73-ML550 100 µL

ULK3, NT (Serine/Threonine-protein Kinase ULK3, Unc-51-like Kinase 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Tgfbi 3'UTR Luciferase Stable Cell Line
TU221826 1.0 mL

Tgfbi 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Hamster albumin Antibody
orb22331 1 mL

Rabbit Hamster albumin Antibody

Sign In for Pricing
View Details
Kinesin Antibody Blocking Peptide
orb1515435 500 µg

Kinesin Antibody Blocking Peptide

Sign In for Pricing
View Details
Glycine-2-13C
FG176248-01 0.25 g

Glycine-2-13C

Sign In for Pricing
View Details