Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2C1 (OR2C1)

This Recombinant Human Olfactory receptor 2C1 (OR2C1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2C1, OLFmf3, Olfactory receptor 2C2, Olfactory receptor OR16-1, Olfactory receptor OR16-2

UniProt

O95371

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMY FFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAF DRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCE VPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNT CLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA LRRLLGKGREVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-9 protein (His Tag)
PKSM041475-01 20 µg

Recombinant Mouse IL-9 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-9 protein (His Tag)
PKSM041475-02 100 µg

Recombinant Mouse IL-9 protein (His Tag)

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-01 24 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-02 48 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-03 96 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), 0.2mg/mL
BNUB1505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), 0.2mg/mL

Sign In for Pricing
View Details