Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1493 (Olr1493)

This Recombinant Rat Olfactory receptor 1493 (Olr1493) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1493, Olfactory receptor-like protein I8

UniProt

P23271

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNKTVITHFLLLGLPIPPEHQQLFFALFLIMYLTTFLGNLLIVVLVQLDSHLHTPMYLF LSNLSFSDLCFSSVTMLKLLQNIQSQVPSISYAGCLTQIFFFLLFGYLGNFLLVAMAYDR YVAICFPLHYTNIMSHKLCTCLLLVFWIMTSSHAMMHTLLAARLSFCENNVLLNFFCDLF VLLKLACSDTYVNELMIHIMGVIIIVIPFVLIVISYAKIISSILKVPSTQSIHKVFSTCG SHLSVVSLFYGTIIGLYLCPSGDNFSLKGSAMAMMYTVVTPMLNPFIYSLRNRDMKQALI RVTCSKKISLPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEDC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA811443AM 100 µL

TEDC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2858R), 0.2mg/mL
BNUB2858-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2858R), 0.2mg/mL

Sign In for Pricing
View Details
MPST (NM_001013440) Human Recombinant Protein
TP324963L 1 mg

MPST (NM_001013440) Human Recombinant Protein

Sign In for Pricing
View Details
KCNMB4 Human Gene Knockout Kit (CRISPR)
KN402318 1 Kit

KCNMB4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CABP4 activation kit by CRISPRa
GA111335 1 Kit

Human CABP4 activation kit by CRISPRa

Sign In for Pricing
View Details
Sstr5 Mouse Gene Knockout Kit (CRISPR)
KN516779 1 Kit

Sstr5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details