Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1493 (Olr1493)

This Recombinant Rat Olfactory receptor 1493 (Olr1493) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1493, Olfactory receptor-like protein I8

UniProt

P23271

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNKTVITHFLLLGLPIPPEHQQLFFALFLIMYLTTFLGNLLIVVLVQLDSHLHTPMYLF LSNLSFSDLCFSSVTMLKLLQNIQSQVPSISYAGCLTQIFFFLLFGYLGNFLLVAMAYDR YVAICFPLHYTNIMSHKLCTCLLLVFWIMTSSHAMMHTLLAARLSFCENNVLLNFFCDLF VLLKLACSDTYVNELMIHIMGVIIIVIPFVLIVISYAKIISSILKVPSTQSIHKVFSTCG SHLSVVSLFYGTIIGLYLCPSGDNFSLKGSAMAMMYTVVTPMLNPFIYSLRNRDMKQALI RVTCSKKISLPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (DC10), CF740 conjugate, 0.1mg/mL
BNC740021-100 1x 100 µL

Cytokeratin 18 (DC10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Quin-2, AM *CAS 83104-85-2*
21050-AAT 1 mg

Quin-2, AM *CAS 83104-85-2*

Sign In for Pricing
View Details
Recombinant GSK3 alpha Antibody
RC-5012-01 50 μL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
Recombinant GSK3 alpha Antibody
RC-5012-02 100 µL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
Recombinant GSK3 alpha Antibody
RC-5012-03 1 mL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
ZFY (NM_001145276) Human Over-expression Lysate
LC428780 20 µg

ZFY (NM_001145276) Human Over-expression Lysate

Sign In for Pricing
View Details