Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR4 (COR4)

This Recombinant Chicken Olfactory receptor-like protein COR4 (COR4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR4

UniProt

P37070

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYIGCILQYFSFVLLTVTESLLLAVMAY DRYVAICKPLLYPSIMTKAVCWRLVKGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTTLNELLVFIFGSLFAMSSIITILISYVFIILTVVRIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRVIATNVWIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM134 (NM_001078650) Human Over-expression Lysate
LC421502 20 µg

TMEM134 (NM_001078650) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), Biotin conjugate, 0.1mg/mL
BNCB0265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blood Transport Box BBBF-306
BBBF-306 Each

Blood Transport Box BBBF-306

Sign In for Pricing
View Details
HOXB13 Rabbit Polyclonal Antibody
TA364479 100 µL

HOXB13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMAD4 Mouse Monoclonal Antibody [Clone ID: 4G1C6]
AM06501SU-N 100 µL

SMAD4 Mouse Monoclonal Antibody [Clone ID: 4G1C6]

Sign In for Pricing
View Details
CD32A (FCGR2A) (NM_021642) Human Recombinant Protein
TP305786M 100 µg

CD32A (FCGR2A) (NM_021642) Human Recombinant Protein

Sign In for Pricing
View Details