Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR4 (COR4)

This Recombinant Chicken Olfactory receptor-like protein COR4 (COR4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR4

UniProt

P37070

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYIGCILQYFSFVLLTVTESLLLAVMAY DRYVAICKPLLYPSIMTKAVCWRLVKGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTTLNELLVFIFGSLFAMSSIITILISYVFIILTVVRIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRVIATNVWIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,6-Dihydroxyindoline Hydrobromide
TRC-D679233-50MG 50 mg

5,6-Dihydroxyindoline Hydrobromide

Sign In for Pricing
View Details
Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA502932AM 100 µL

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL
BNC473800-100 1x 100 µL

Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmed6 Mouse Gene Knockout Kit (CRISPR)
KN517683 1 Kit

Tmed6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR1L1 activation kit by CRISPRa
GA108935 1 Kit

Human OR1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IFN-γ Antibody Pair Set
E-KAB-0551 50 µL & 100 µg

Mouse IFN-γ Antibody Pair Set

Sign In for Pricing
View Details