Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR6 (COR6)

This Recombinant Chicken Olfactory receptor-like protein COR6 (COR6) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR6

UniProt

P37072

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISIDLQLQTPMY IFLQNLSFTDAVYSTVITPKMLATFLEETKTISYVGCILQYFSFVLLTVRECLLLAVMAY DRYAAICKPLLYPAIMTKAVCWRLVKGLYSLAFLNFLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTALNELLVFIFGSLFVMSSIITILISYVFIILTVVRIRSKERKYKAFST CTSHLMAVSLFHGTIVFMYFQPANNFSLDKDKIMSLFYTVVIPMLNPLIYSWRNKEVKDA LHRAIATAVLFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTN3 Polyclonal Antibody
ABP58212-01 30 µL

CNTN3 Polyclonal Antibody

Sign In for Pricing
View Details
CNTN3 Polyclonal Antibody
ABP58212-02 100 µL

CNTN3 Polyclonal Antibody

Sign In for Pricing
View Details
CNTN3 Polyclonal Antibody
ABP58212-03 200 µL

CNTN3 Polyclonal Antibody

Sign In for Pricing
View Details
Printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS
P50233R 1000 Units/Pack

Printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
Sdr16c6 Mouse shRNA Plasmid (Locus ID 242286)
TL517714 1 Kit

Sdr16c6 Mouse shRNA Plasmid (Locus ID 242286)

Sign In for Pricing
View Details
ANGEL1 Protein Vector (Rat) (pPB-N-His)
PV253527 500 ng

ANGEL1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details