Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR6 (COR6)

This Recombinant Chicken Olfactory receptor-like protein COR6 (COR6) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR6

UniProt

P37072

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISIDLQLQTPMY IFLQNLSFTDAVYSTVITPKMLATFLEETKTISYVGCILQYFSFVLLTVRECLLLAVMAY DRYAAICKPLLYPAIMTKAVCWRLVKGLYSLAFLNFLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTALNELLVFIFGSLFVMSSIITILISYVFIILTVVRIRSKERKYKAFST CTSHLMAVSLFHGTIVFMYFQPANNFSLDKDKIMSLFYTVVIPMLNPLIYSWRNKEVKDA LHRAIATAVLFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ycf72-1 Antibody
orb837858 2 mg

Ycf72-1 Antibody

Sign In for Pricing
View Details
Phospho-MDMX (Ser367) Rabbit pAb, Pacific Blue conjugated
orb2857313 100 µL

Phospho-MDMX (Ser367) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal CD82/Kai-1 Antibody [Biotin]
NBP1-76775B 0.1 mL

Rabbit Polyclonal CD82/Kai-1 Antibody [Biotin]

Sign In for Pricing
View Details
DMXL2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
18332154 3x 1.0 µg DNA

DMXL2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Tenofovir disoproxil
FT140296-01 5 g

Tenofovir disoproxil

Sign In for Pricing
View Details
Tenofovir disoproxil
FT140296-02 10 g

Tenofovir disoproxil

Sign In for Pricing
View Details