Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR6 (COR6)

This Recombinant Chicken Olfactory receptor-like protein COR6 (COR6) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR6

UniProt

P37072

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISIDLQLQTPMY IFLQNLSFTDAVYSTVITPKMLATFLEETKTISYVGCILQYFSFVLLTVRECLLLAVMAY DRYAAICKPLLYPAIMTKAVCWRLVKGLYSLAFLNFLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTALNELLVFIFGSLFVMSSIITILISYVFIILTVVRIRSKERKYKAFST CTSHLMAVSLFHGTIVFMYFQPANNFSLDKDKIMSLFYTVVIPMLNPLIYSWRNKEVKDA LHRAIATAVLFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Osbpl2 Plasmid
PVT38914 2 µg

pExpress-1-Osbpl2 Plasmid

Sign In for Pricing
View Details
Human Axl Alexa Fluor 647 Antibody (Clone 108724R)
FAB154RR-100UG 100 µg

Human Axl Alexa Fluor 647 Antibody (Clone 108724R)

Sign In for Pricing
View Details
Mouse Matrilin-3 (MATN3) ELISA Kit
AE34179MO-01 48 Tests

Mouse Matrilin-3 (MATN3) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrilin-3 (MATN3) ELISA Kit
AE34179MO-02 96 Tests

Mouse Matrilin-3 (MATN3) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-330-5p miRNA Agomir
MBS8311276-01 5 nmol

hsa-miR-330-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-330-5p miRNA Agomir
MBS8311276-02 10 nmol

hsa-miR-330-5p miRNA Agomir

Sign In for Pricing
View Details