Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 15 (Olfr15)

This Recombinant Mouse Olfactory receptor 15 (Olfr15) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 15, Odorant receptor OR3, Olfactory receptor 256-17

UniProt

P23275

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVDSNSSSGSFILMGVSDHPHLEIIFFAVILASYLLTLVGNLTIILLSRLDARLHTPMY FFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGATECILLVVMAF DRYVAVCRPLHYMTVMNPRLCWGLAAISWLGGLGNSVIQSTFTLQLPFCGHRKVDNFLCE VPAMIKLACGDTSLNEAVLNGVCTFFTVVPVSVILVSYCFIAQAVMKIRSVEGRRKAFNT CVSHLVVVFLFYGSAIYGYLLPAKSSNQSQGKFISLFYSVVTPMVNPLIYTLRNKEVKGA LGRLLGKGRGAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-κB p65 Rabbit Monoclonal Antibody
E28G1604 100 µL

NF-κB p65 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MED27 Antibody - middle region : Biotin (ARP33743_P050-Biotin)
ARP33743_P050-Biotin 100 µL

MED27 Antibody - middle region : Biotin (ARP33743_P050-Biotin)

Sign In for Pricing
View Details
RPS28 Rabbit Polyclonal Antibody (PE)
orb2589188 100 µg

RPS28 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SA1 (STAG1) Rabbit Polyclonal Antibody
TA364994 100 µL

SA1 (STAG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Protein FAM167B, FAM167B ELISA Kit
MBS9319866-01 48 Well

Mouse Protein FAM167B, FAM167B ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM167B, FAM167B ELISA Kit
MBS9319866-02 96 Well

Mouse Protein FAM167B, FAM167B ELISA Kit

Sign In for Pricing
View Details