Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 15 (Olfr15)

This Recombinant Mouse Olfactory receptor 15 (Olfr15) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 15, Odorant receptor OR3, Olfactory receptor 256-17

UniProt

P23275

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVDSNSSSGSFILMGVSDHPHLEIIFFAVILASYLLTLVGNLTIILLSRLDARLHTPMY FFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGATECILLVVMAF DRYVAVCRPLHYMTVMNPRLCWGLAAISWLGGLGNSVIQSTFTLQLPFCGHRKVDNFLCE VPAMIKLACGDTSLNEAVLNGVCTFFTVVPVSVILVSYCFIAQAVMKIRSVEGRRKAFNT CVSHLVVVFLFYGSAIYGYLLPAKSSNQSQGKFISLFYSVVTPMVNPLIYTLRNKEVKGA LGRLLGKGRGAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51T1 siRNA (Human)
CRJ8148-01 15 nmol

OR51T1 siRNA (Human)

Sign In for Pricing
View Details
OR51T1 siRNA (Human)
CRJ8148-02 30 nmol

OR51T1 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal DNMBP Antibody [DyLight 755]
NBP1-71830IR 0.1 mL

Rabbit Polyclonal DNMBP Antibody [DyLight 755]

Sign In for Pricing
View Details
CD81 Monoclonal Antibody
orb1821373 0.05 mg

CD81 Monoclonal Antibody

Sign In for Pricing
View Details
RPL6 ORF Vector (Human) (pORF)
41753011 1.0 µg DNA

RPL6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SLC38A3 Polyclonal Conjugated Antibody
C30570 100 µL

SLC38A3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details