Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR5 (COR5)

This Recombinant Chicken Olfactory receptor-like protein COR5 (COR5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR5

UniProt

P37071

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGNCTTPTTFILSGLTDNPRLQMPLFMVFLAIYTITLLANLGLIALISVDFHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERRTISYVGCILQYFSFVLLTSSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVEGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTTLNELLVFIFGSWFAMSSIITTPISYVFIILTVVRIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRVIATNVWIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mastoparan 17 (free acid)
FM108842-01 5 mg

Mastoparan 17 (free acid)

Sign In for Pricing
View Details
Mastoparan 17 (free acid)
FM108842-02 10 mg

Mastoparan 17 (free acid)

Sign In for Pricing
View Details
Mastoparan 17 (free acid)
FM108842-03 25 mg

Mastoparan 17 (free acid)

Sign In for Pricing
View Details
Fam69b Mouse shRNA Plasmid (Locus ID 56279)
TR514048 1 Kit

Fam69b Mouse shRNA Plasmid (Locus ID 56279)

Sign In for Pricing
View Details
Recombinant Rat ALK-1 Protein
VAng-2855Lsx-1mg 1 mg

Recombinant Rat ALK-1 Protein

Sign In for Pricing
View Details
EFHA2 Rabbit Polyclonal Antibody (HRP)
orb2104478 100 µL

EFHA2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details