Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR5 (COR5)

This Recombinant Chicken Olfactory receptor-like protein COR5 (COR5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR5

UniProt

P37071

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGNCTTPTTFILSGLTDNPRLQMPLFMVFLAIYTITLLANLGLIALISVDFHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERRTISYVGCILQYFSFVLLTSSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVEGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTTLNELLVFIFGSWFAMSSIITTPISYVFIILTVVRIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRVIATNVWIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP11L1 Human Over-expression Lysate
orb1349547 100 µg

TCP11L1 Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit
MBS1605476-01 48 Well

Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit
MBS1605476-02 96 Well

Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit
MBS1605476-03 5x 96 Well

Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit
MBS1605476-04 10x 96 Well

Rat Tyrosine-protein phosphatase non-receptor type 6, PTPN6 ELISA Kit

Sign In for Pricing
View Details
Human anti-human IL-1β mAb (95)
E4A09D02-h9-100 100 µg

Human anti-human IL-1β mAb (95)

Sign In for Pricing
View Details