Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 867 (Olr867)

This Recombinant Rat Olfactory receptor 867 (Olr867) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 867, Gustatory receptor GUST27, Olfactory receptor 1172

UniProt

P34987

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILNCNPFSGLFLSMYLVTVLGNLLIILAVSSNSHLHNLMYFFLSNLSFVDICFISTTIP KMLVNIHSQTKDISYIECLSQVYFLTTFGGMDNFLLTLMACDRYVAICHPLNYTVIMNLQ LCALLILMFWLIMFCVSLIHVLLMNELNFSRGTEIPHFFCELAQVLKVANSDTHINNVFM YVVTSLLGLIPMTGILMSYSQIASSLLKMSSSVSKYKAFSTCGSHLCVVSLFYGSATIVY FCSSVLHSTHKKMIASLMYTVISPMLNPFIYSLRNKDVKGALGKLFIRVASCPLWSKDFR PKFILKPERQSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cathepsin D (CTSD) activation kit by CRISPRa
GA101067 1 Kit

Human Cathepsin D (CTSD) activation kit by CRISPRa

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), 0.2mg/mL
BNUB2350-500 1x 500 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), 0.2mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 1mg/mL
BNUM2284-50 1x 50 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Intervertebral disc
CS807934 5x 5 µm

Tissue FFPE Sections, Intervertebral disc

Sign In for Pricing
View Details
Atf6b Mouse Gene Knockout Kit (CRISPR)
KN501722 1 Kit

Atf6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL
BNC741948-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details