Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 11 (Olfr11)

This Recombinant Mouse Olfactory receptor 11 (Olfr11) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 11, Odorant receptor M49, Olfactory receptor 256-11

UniProt

Q60890

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWANESITGEFVLLGFSDQPWLEFPLFVVFLTSYIVTIFGNLNIILVSHLDPKLHTPMY FFLTNLSVIDLCYITCTVPQMLVNLRSIRKVISFGGCVVQLFMFLALGATECVLLPVMSF DRFVAICRPLHYSVIMHQRLCLQLAAVSWIIGFGNSVWLSILTLQLPRCGHYVIDHFLCE VPALLKLSCVDVTANEAELFFVSVFFHLTPLSLILTSYAFIARAILKIQSAEGRQKAFGT CSSHLIVVSLFYGTALSVYFLPPSPHSKNRRKMVPLFYGIIAPMLNPLIYTLRNKEVKDA FKRLIKRVFLSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP20-3 activation kit by CRISPRa
GA117360 1 Kit

Human KRTAP20-3 activation kit by CRISPRa

Sign In for Pricing
View Details
R-Phycoerythrin (RPE), lyophilized solid, ammonium sulfate free
#29091-10mg 1x 10 mg

R-Phycoerythrin (RPE), lyophilized solid, ammonium sulfate free

Sign In for Pricing
View Details
Cdc20 (CDC20/1102), Biotin conjugate, 0.1mg/mL
BNCB1102-100 1x 100 µL

Cdc20 (CDC20/1102), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI6H6]
CF810826 100 µg

PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI6H6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505702 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Uqcc3 Mouse Gene Knockout Kit (CRISPR)
KN501024 1 Kit

Uqcc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details