Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 11 (Olfr11)

This Recombinant Mouse Olfactory receptor 11 (Olfr11) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 11, Odorant receptor M49, Olfactory receptor 256-11

UniProt

Q60890

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWANESITGEFVLLGFSDQPWLEFPLFVVFLTSYIVTIFGNLNIILVSHLDPKLHTPMY FFLTNLSVIDLCYITCTVPQMLVNLRSIRKVISFGGCVVQLFMFLALGATECVLLPVMSF DRFVAICRPLHYSVIMHQRLCLQLAAVSWIIGFGNSVWLSILTLQLPRCGHYVIDHFLCE VPALLKLSCVDVTANEAELFFVSVFFHLTPLSLILTSYAFIARAILKIQSAEGRQKAFGT CSSHLIVVSLFYGTALSVYFLPPSPHSKNRRKMVPLFYGIIAPMLNPLIYTLRNKEVKDA FKRLIKRVFLSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kif1a activation kit by CRISPRa
GA202300 1 Kit

Mouse Kif1a activation kit by CRISPRa

Sign In for Pricing
View Details
SDK2 (NM_001144952) Human Over-expression Lysate
LY428601 100 µg

SDK2 (NM_001144952) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody
TA374384 100 µL

Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc28a1 Mouse Gene Knockout Kit (CRISPR)
KN516018 1 Kit

Slc28a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C9orf41 (CARNMT1) activation kit by CRISPRa
GA115302 1 Kit

Human C9orf41 (CARNMT1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody
HA723945B 100 µL

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details