Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 11 (Olfr11)

This Recombinant Mouse Olfactory receptor 11 (Olfr11) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 11, Odorant receptor M49, Olfactory receptor 256-11

UniProt

Q60890

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWANESITGEFVLLGFSDQPWLEFPLFVVFLTSYIVTIFGNLNIILVSHLDPKLHTPMY FFLTNLSVIDLCYITCTVPQMLVNLRSIRKVISFGGCVVQLFMFLALGATECVLLPVMSF DRFVAICRPLHYSVIMHQRLCLQLAAVSWIIGFGNSVWLSILTLQLPRCGHYVIDHFLCE VPALLKLSCVDVTANEAELFFVSVFFHLTPLSLILTSYAFIARAILKIQSAEGRQKAFGT CSSHLIVVSLFYGTALSVYFLPPSPHSKNRRKMVPLFYGIIAPMLNPLIYTLRNKEVKDA FKRLIKRVFLSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS628032 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
FOXD3 Rabbit Polyclonal Antibody
R1107-4 100 µL

FOXD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PGBD3 Mouse Monoclonal Antibody [Clone ID: OTI1A3]
CF810313 100 µg

PGBD3 Mouse Monoclonal Antibody [Clone ID: OTI1A3]

Sign In for Pricing
View Details
PLD4 (NM_138790) Human Over-expression Lysate
LC403375 20 µg

PLD4 (NM_138790) Human Over-expression Lysate

Sign In for Pricing
View Details
Calnexin (CANX) Rabbit Polyclonal Antibody
TA374243 100 µL

Calnexin (CANX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant GBA Antibody
RC-16721-01 50 μL

Recombinant GBA Antibody

Sign In for Pricing
View Details