Recombinant Mouse Olfactory receptor 3 (Olfr3)
This Recombinant Mouse Olfactory receptor 3 (Olfr3) spans the amino acid sequence from region 1-313.
Product Specifications
Product Name Alternative
Olfactory receptor 3, Odorant receptor K10, Olfactory receptor 136-14
UniProt
Q60879
Expression Region
1-313
Origin
Mus musculus (Mouse)
Field of Research
Neuroscience; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRLKNHSSVSEFLLLGFPIRPEQGGIFFSLFLAMYLITVLGNLLIILLIRLDSHLHTPMY FFLSHLAFTDISFSSVTVPKMLTKVQNQPIPITYEECVSQTYFFIFFADLDSFLITSMAY DRYMAICHPLHYITIMSQSRCAMLVAVSWVIASACALLHSLLLDQLSFCADHTVPHFFCD LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPTTKGICKALST CGSHLSVVALYYGSIIGLYFLPPSNSKINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGA LKKLLSKKTEFSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
381583 100 µL
CaMKIV (Brain Ca (2) Calmodulin Dependent Protein Kinase Type 4, Brain Ca (2) Calmodulin Dependent Protein Kinase Type IV, Brain Ca -Calmodulin Dependent Protein Kinase Type IV, Calcium/Calmodulin Dependent Protein Kinase Type 4 Catalytic Chain, Calcium/Calmodulin Dependent Protein Kinase Type IV Catalytic chain, Calcium/Calmodulin Dependent Protein Kinase IV, Calcium/Calmodulin Dependent Protein Kinase Type IV, Calcium/Calmodulin-Dependent Protein Kinase Type IV, CAM Kinase 4, CAM Kinase GR, CAM Kinase IV, CAM Kinase-GR, CaMK 4, CAMK GR, CaMK IV, CaMK4, CaMKGR, IV)
Sign In for Pricing
View Details 
246305-AP 100 µL
FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (AP) discontinued
Sign In for Pricing
View Details