Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 3 (Olfr3)

This Recombinant Mouse Olfactory receptor 3 (Olfr3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 3, Odorant receptor K10, Olfactory receptor 136-14

UniProt

Q60879

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKNHSSVSEFLLLGFPIRPEQGGIFFSLFLAMYLITVLGNLLIILLIRLDSHLHTPMY FFLSHLAFTDISFSSVTVPKMLTKVQNQPIPITYEECVSQTYFFIFFADLDSFLITSMAY DRYMAICHPLHYITIMSQSRCAMLVAVSWVIASACALLHSLLLDQLSFCADHTVPHFFCD LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPTTKGICKALST CGSHLSVVALYYGSIIGLYFLPPSNSKINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGA LKKLLSKKTEFSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF250 Recombinant Protein (Human)
RP035653 100 µg

ZNF250 Recombinant Protein (Human)

Sign In for Pricing
View Details
FLT3 Ligand Protein, Human, Recombinant
TMPY-06873-01 5 µg

FLT3 Ligand Protein, Human, Recombinant

Sign In for Pricing
View Details
FLT3 Ligand Protein, Human, Recombinant
TMPY-06873-02 10 µg

FLT3 Ligand Protein, Human, Recombinant

Sign In for Pricing
View Details
FLT3 Ligand Protein, Human, Recombinant
TMPY-06873-03 20 µg

FLT3 Ligand Protein, Human, Recombinant

Sign In for Pricing
View Details
FLT3 Ligand Protein, Human, Recombinant
TMPY-06873-04 50 µg

FLT3 Ligand Protein, Human, Recombinant

Sign In for Pricing
View Details
FLT3 Ligand Protein, Human, Recombinant
TMPY-06873-05 100 µg

FLT3 Ligand Protein, Human, Recombinant

Sign In for Pricing
View Details