Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1J2 (OR1J2)

This Recombinant Human Olfactory receptor 1J2 (OR1J2) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1J2, HSA5, HTPCRX15, OST044, Olfactory receptor 1J3, Olfactory receptor 1J5, Olfactory receptor OR9-19

UniProt

Q8NGS2

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY FFLSHLALTDISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAY DRYVAICHPLHYTVIMREELCVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCD LAALLKLSCSDIFLNELVMFTVGVVVITLPFMCILVSYGYIGATILRVPSTKGIHKALST CGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTVVTPMLNPFIYSLRNRDMKEA LGKLFSRATFFSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD220/INSR Polyclonal Antibody
E55A00436 100 µg

CD220/INSR Polyclonal Antibody

Sign In for Pricing
View Details
PSKH1 293 Cell Lysate
401791 0.1 mg

PSKH1 293 Cell Lysate

Sign In for Pricing
View Details
ATG4C Antibody
MBS7124841-01 0.05 mL

ATG4C Antibody

Sign In for Pricing
View Details
ATG4C Antibody
MBS7124841-02 0.1 mL

ATG4C Antibody

Sign In for Pricing
View Details
ATG4C Antibody
MBS7124841-03 5x 0.1 mL

ATG4C Antibody

Sign In for Pricing
View Details
Recombinant Human Sperm surface protein Sp17 (SPA17), partial
MBS963886-01 0.02 mg (E-Coli)

Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Sign In for Pricing
View Details