Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1J2 (OR1J2)

This Recombinant Human Olfactory receptor 1J2 (OR1J2) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1J2, HSA5, HTPCRX15, OST044, Olfactory receptor 1J3, Olfactory receptor 1J5, Olfactory receptor OR9-19

UniProt

Q8NGS2

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY FFLSHLALTDISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAY DRYVAICHPLHYTVIMREELCVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCD LAALLKLSCSDIFLNELVMFTVGVVVITLPFMCILVSYGYIGATILRVPSTKGIHKALST CGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTVVTPMLNPFIYSLRNRDMKEA LGKLFSRATFFSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCE1E Protein Lysate (Human) with C-Ha Tag
26347031 100 µg

LCE1E Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PRDX6 Rabbit pAb
E2502031 100 µL

PRDX6 Rabbit pAb

Sign In for Pricing
View Details
Magea1 siRNA Oligos set (Mouse)
27909174 3x 5 nmol

Magea1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GPM6B Polyclonal Antibody, PerCP Conjugated
bs-11847R-PerCP-TR 20 µL

GPM6B Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Defb8 ORF Vector (Mouse) (pORF)
18004014 1.0 µg DNA

Defb8 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Cadherin-22 shRNA (h) Lentiviral Particles
sc-72775-V 200 µL

Cadherin-22 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details