Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6M1 (OR6M1)

This Recombinant Human Olfactory receptor 6M1 (OR6M1) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 6M1, Olfactory receptor OR11-271

UniProt

Q8NGM8

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNWSTVTEITLIAFPALLEIRISLFVVLVVTYTLTATGNITIISLIWIDHRLQTPMYFF LSNLSFLDILYTTVITPKLLACLLGEEKTISFAGCMIQTYFYFFLGTVEFILLAVMSFDR YMAICDPLHYTVIMNSRACLLLVLGCWVGAFLSVLFPTIVVTRLPYCRKEINHFFCDIAP LLQVACINTHLIEKINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCAS HITVVSIAHGSNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE TVNRIMTLIQRKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLULP4 ORF Vector (Human) (pORF)
21658011 1.0 µg DNA

GLULP4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
AATK (Apoptosis-Associated Tyrosine Kinase, AATYK, AATYK1, KIAA0641, LMR1, LMTK1, p35BP) (MaxLight 750) discontinued
242974-ML750 100 µL

AATK (Apoptosis-Associated Tyrosine Kinase, AATYK, AATYK1, KIAA0641, LMR1, LMTK1, p35BP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Telomerase Reverse Transcriptase (TERT) Antibody
abx324319-01 50 µg

Telomerase Reverse Transcriptase (TERT) Antibody

Sign In for Pricing
View Details
Telomerase Reverse Transcriptase (TERT) Antibody
abx324319-02 100 µg

Telomerase Reverse Transcriptase (TERT) Antibody

Sign In for Pricing
View Details
PPM1A (NM_021003) Human Recombinant Protein
TP302070 20 µg

PPM1A (NM_021003) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal PIG3 Antibody (OTI3B11) [Alexa Fluor 594]
NBP2-73400AF594 0.1 mL

Mouse Monoclonal PIG3 Antibody (OTI3B11) [Alexa Fluor 594]

Sign In for Pricing
View Details