Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D18 (OR5D18)

This Recombinant Human Olfactory receptor 5D18 (OR5D18) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 5D18, Olfactory receptor OR11-143, Olfactory receptor OR11-152

UniProt

Q8NGL1

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLTDRNTSGTTFTLLGFSDYPELQVPLFLVFLAIYNVTVLGNIGLIVIIKINPKLHTPM YFFLSQLSFVDFCYSSIIAPKMLVNLVVKDRTISFLGCVVQFFFFCTFVVTESFLLAVMA YDRFVAICNPLLYTVNMSQKLCVLLVVGSYAWGVSCSLELTCSALKLCFHGFNTINHFFC EFSSLLSLSCSDTYINQWLLFFLATFNEISTLLIVLTSYAFIVVTILKMRSVSGRRKAFS TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKD TVTEILDTKVFSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit SMC Basal Medium
Rb310-500 500 mL

Rabbit SMC Basal Medium

Sign In for Pricing
View Details
SHC2 Rabbit Polyclonal Antibody (BF555)
orb2537382 100 µL

SHC2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Rpp38 Mouse qPCR Template Standard (NM_001013376)
MK201618 1 Kit

Rpp38 Mouse qPCR Template Standard (NM_001013376)

Sign In for Pricing
View Details
FCCP 50mg
A16545-50 50 mg

FCCP 50mg

Sign In for Pricing
View Details
PHKG2 (NM_001172432) Human Tagged Lenti ORF Clone
RC229959L4 10 µg

PHKG2 (NM_001172432) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-EGFL4 Antibody
A12840 100 µL

Anti-EGFL4 Antibody

Sign In for Pricing
View Details