Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D18 (OR5D18)

This Recombinant Human Olfactory receptor 5D18 (OR5D18) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 5D18, Olfactory receptor OR11-143, Olfactory receptor OR11-152

UniProt

Q8NGL1

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLTDRNTSGTTFTLLGFSDYPELQVPLFLVFLAIYNVTVLGNIGLIVIIKINPKLHTPM YFFLSQLSFVDFCYSSIIAPKMLVNLVVKDRTISFLGCVVQFFFFCTFVVTESFLLAVMA YDRFVAICNPLLYTVNMSQKLCVLLVVGSYAWGVSCSLELTCSALKLCFHGFNTINHFFC EFSSLLSLSCSDTYINQWLLFFLATFNEISTLLIVLTSYAFIVVTILKMRSVSGRRKAFS TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKD TVTEILDTKVFSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pramel52-ps qPCR Primer Pair
QM48670S 200 Tests

Mouse Pramel52-ps qPCR Primer Pair

Sign In for Pricing
View Details
TTTY17B sgRNA CRISPR Lentivector set (Human)
K2555901 3x 1.0 µg

TTTY17B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF488A conjugate, 0.1mg/mL
BNC881748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Haptoglobin Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-1808R-PerCP-Cy5.5 100 µL

Haptoglobin Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
TCF-1 (Transcription Factor 7, TCF-7, T-Cell-specific Transcription Factor 1, T-Cell Factor 1, TCF-1, TCF7, TCF1) discontinued
226226-01 50 µL

TCF-1 (Transcription Factor 7, TCF-7, T-Cell-specific Transcription Factor 1, T-Cell Factor 1, TCF-1, TCF7, TCF1) discontinued

Sign In for Pricing
View Details
TCF-1 (Transcription Factor 7, TCF-7, T-Cell-specific Transcription Factor 1, T-Cell Factor 1, TCF-1, TCF7, TCF1) discontinued
226226-02 100 µL

TCF-1 (Transcription Factor 7, TCF-7, T-Cell-specific Transcription Factor 1, T-Cell Factor 1, TCF-1, TCF7, TCF1) discontinued

Sign In for Pricing
View Details