Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4Q3 (OR4Q3)

This Recombinant Human Olfactory receptor 4Q3 (OR4Q3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3

UniProt

Q8NH05

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQAHAHLLQSPM YYFLGHLSFIDLCLSCVTVPKMLGDFLQQGKSISFSGCLAQIYFLHFLGASEMFLLTVMA YDRYVAICNPLRYLTVMNPQLCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYC DVPQVIKLACMDTYVVEVLVIANSGLLSLVCFLVLLFSYAIILITLRTHFCQGQNKVFST CASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMK KLRIKPCGIPLPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DPYS Protein, His (Fc)-Avi-tagged
DPYS-2519M 50 µg

Recombinant Mouse DPYS Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Human NOD1 knockout cell line
ABC-KH10201 1 Vial

Human NOD1 knockout cell line

Sign In for Pricing
View Details
PCD513B-1-CD33
PPL00661-4c 1 Each

PCD513B-1-CD33

Sign In for Pricing
View Details
Family With Sequence Similarity 19, Member A5 (FAM19A5) Magnetic Luminex Assay Kit
LKU604186 96 Tests

Family With Sequence Similarity 19, Member A5 (FAM19A5) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
QPCR Kit DNA Human Papil
MOL8068 1 Each

QPCR Kit DNA Human Papil

Sign In for Pricing
View Details
OR1L8 CRISPR Activation Plasmid (h2)
sc-414457-ACT-2 20 µg

OR1L8 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details