Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4Q3 (OR4Q3)

This Recombinant Human Olfactory receptor 4Q3 (OR4Q3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3

UniProt

Q8NH05

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQAHAHLLQSPM YYFLGHLSFIDLCLSCVTVPKMLGDFLQQGKSISFSGCLAQIYFLHFLGASEMFLLTVMA YDRYVAICNPLRYLTVMNPQLCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYC DVPQVIKLACMDTYVVEVLVIANSGLLSLVCFLVLLFSYAIILITLRTHFCQGQNKVFST CASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMK KLRIKPCGIPLPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pi15 shRNA (m) Lentiviral Particles
sc-152246-V 200 µL

Pi15 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit
MBS7252363-01 48 Well

Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit

Sign In for Pricing
View Details
Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit
MBS7252363-02 96 Well

Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit

Sign In for Pricing
View Details
Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit
MBS7252363-03 5x 96 Well

Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit

Sign In for Pricing
View Details
Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit
MBS7252363-04 10x 96 Well

Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit

Sign In for Pricing
View Details
KLH22, CT (KLHL22, Kelch-like protein 22) (APC) discontinued
037537-APC 200 µL

KLH22, CT (KLHL22, Kelch-like protein 22) (APC) discontinued

Sign In for Pricing
View Details