Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1J4 (OR1J4)

This Recombinant Human Olfactory receptor 1J4 (OR1J4) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1J4, HTPCRX01, Olfactory receptor OR9-21

UniProt

Q8NGS1

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRENQSSVSEFLLLDLPIWPEQQAVFFTLFLGMYLITVLGNLLIILLIRLDSHLHTPMF FFLSHLALTDISLSSVTVPKMLLSMQTQDQSILYAGCVTQMYFFIFFTDLDNFLLTSMAY DRYVAICHPLRYTTIMKEGLCNLLVTVSWILSCTNALSHTLLLAQLSFCADNTIPHFFCD LVALLKLSCSDISLNELVIFTVGQAVITLPLICILISYGHIGVTILKAPSTKGIFKALST CGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLNPFIYSLRNRDIKGA LERLFNRATVLSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydrazinobenzoic Acid Hydrochloride
TRC-H716575-1G 1 g

4-Hydrazinobenzoic Acid Hydrochloride

Sign In for Pricing
View Details
21-Deacetoxy Deflazacort
TRC-D198000-10MG 10 mg

21-Deacetoxy Deflazacort

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704778 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Rat AgRP (Agouti Related Protein) CLIA Kit
E-CL-R0744-01 24 Tests

Rat AgRP (Agouti Related Protein) CLIA Kit

Sign In for Pricing
View Details
Rat AgRP (Agouti Related Protein) CLIA Kit
E-CL-R0744-02 48 Tests

Rat AgRP (Agouti Related Protein) CLIA Kit

Sign In for Pricing
View Details
Rat AgRP (Agouti Related Protein) CLIA Kit
E-CL-R0744-03 96 Tests

Rat AgRP (Agouti Related Protein) CLIA Kit

Sign In for Pricing
View Details