Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 24 (Olfr24)

This Recombinant Mouse Olfactory receptor 24 (Olfr24) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 24, Olfactory receptor 132-1, Olfactory receptor TPCR51

UniProt

Q8VFM9

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPQNHTSASEFILLGLSEKPDHDPVLFSLFLCMYMITVVGNLLIILAISFDSHLHTPMY FFLANLSLVDFCLATNTVPKMLVNIQTRNKSISYPCCLTQMYFFHFFGIMDSVLIAVMAY DRFVAICHPLHYSTIMSPRLCGLLVGVPWVYSCFISLTHILLMARLVFCGKNELPHYFCD LTPLLRLSCTDTTVNKIFVLIVAGMVIATPFVCILASYARIIVAIMKVPSAGGRKKAFST CSSHLSVVALFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA LKKIINRKISTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLF5 Pre-designed siRNA Set B
SI008237B 1 Each

Human KLF5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
B-RAF (Phospho-Ser446) Antibody
12064-01 50 µL

B-RAF (Phospho-Ser446) Antibody

Sign In for Pricing
View Details
B-RAF (Phospho-Ser446) Antibody
12064-02 100 µL

B-RAF (Phospho-Ser446) Antibody

Sign In for Pricing
View Details
Tmprss4 AAV siRNA Pooled Vector
47150164 1.0 µg

Tmprss4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ALDH3A2 Monoclonal Antibody
RDSA55130 100 µL

ALDH3A2 Monoclonal Antibody

Sign In for Pricing
View Details
IRF2 Rabbit Polyclonal Antibody (Cy5.5)
orb1068000 100 µL

IRF2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details