Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 24 (Olfr24)

This Recombinant Mouse Olfactory receptor 24 (Olfr24) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 24, Olfactory receptor 132-1, Olfactory receptor TPCR51

UniProt

Q8VFM9

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPQNHTSASEFILLGLSEKPDHDPVLFSLFLCMYMITVVGNLLIILAISFDSHLHTPMY FFLANLSLVDFCLATNTVPKMLVNIQTRNKSISYPCCLTQMYFFHFFGIMDSVLIAVMAY DRFVAICHPLHYSTIMSPRLCGLLVGVPWVYSCFISLTHILLMARLVFCGKNELPHYFCD LTPLLRLSCTDTTVNKIFVLIVAGMVIATPFVCILASYARIIVAIMKVPSAGGRKKAFST CSSHLSVVALFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA LKKIINRKISTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4921515J06Rik Protein Lysate (Mouse) with C-HA Tag
10578034 100 µg

4921515J06Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
VASH1 Polyclonal Antibody
A57185-020 20 µL

VASH1 Polyclonal Antibody

Sign In for Pricing
View Details
Olr526 (NM_001001375) Rat Tagged Lenti ORF Clone
RR207701L4 10 µg

Olr526 (NM_001001375) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD86 (C86/1146), CF594 conjugate, 0.1mg/mL
BNC941146-500 1x 500 µL

CD86 (C86/1146), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mmu-miR-5122 antagomir
HY-RI03266A-01 5 nmol

Mmu-miR-5122 antagomir

Sign In for Pricing
View Details
Mmu-miR-5122 antagomir
HY-RI03266A-02 20 nmol

Mmu-miR-5122 antagomir

Sign In for Pricing
View Details