Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4E2 (OR4E2)

This Recombinant Human Olfactory receptor 4E2 (OR4E2) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 4E2, Olfactory receptor OR14-42

UniProt

Q8NGC2

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMY FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQLFFLHLFACAEIFLLIIVAY DRYVAICTPLHYPNVMNMRVCIQLVFALWLGGTVHSLGQTFLTIRLPYCGPNIIDSYFCD VPLVIKLACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRQKALSTC SAHFMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ LRQRQVFFTKSYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TBP/Tata Binding Protein Tbp Rabbit Monoclonal Antibody, Carrier-free
M00302-carrier-free 100 µL

Anti-TBP/Tata Binding Protein Tbp Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
NKD1 Polyclonal Conjugated Antibody
orb1626848 100 µL

NKD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-GM-CSF/CSF2 Antibody Picoband®, Dylight550 Conjugate
PA1456-Dylight550 100 µg

Anti-GM-CSF/CSF2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
PLV3-Ubc-Fzr1-3xFLAG-Hyg Plasmid
PVT68746 2 µg

PLV3-Ubc-Fzr1-3xFLAG-Hyg Plasmid

Sign In for Pricing
View Details
Recombinant Human BMP7 Protein, N-His
orb2836286-01 20 µg

Recombinant Human BMP7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BMP7 Protein, N-His
orb2836286-02 50 µg

Recombinant Human BMP7 Protein, N-His

Sign In for Pricing
View Details