Recombinant Human Olfactory receptor 4E2 (OR4E2)
This Recombinant Human Olfactory receptor 4E2 (OR4E2) spans the amino acid sequence from region 1-313.
Product Specifications
Product Name Alternative
Olfactory receptor 4E2, Olfactory receptor OR14-42
UniProt
Q8NGC2
Expression Region
1-313
Origin
Homo sapiens (Human)
Field of Research
Neuroscience; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMY FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQLFFLHLFACAEIFLLIIVAY DRYVAICTPLHYPNVMNMRVCIQLVFALWLGGTVHSLGQTFLTIRLPYCGPNIIDSYFCD VPLVIKLACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRQKALSTC SAHFMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ LRQRQVFFTKSYT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
168672-AF-HRP 100 µL
CD1b (A1 domain, CD1A, Cortical thymocyte antigen CD1A, hTa1 thymocyte antigen, Ly38, T cell surface glycoprotein CD1a, T6/Leu6) (HRP)
Sign In for Pricing
View Details 
MBS6398289-01 0.1 mL
VEGFR-1 (Vascular Endothelial Growth Factor Receptor 1, Fms-like Tyrosine Kinase 1, FLT-1, Tyrosine-protein Kinase FRT, Tyrosine-protein Kinase Receptor FLT, Vascular Permeability Factor Receptor, FLT1, FLT, FRT) (MaxLight 550)
Sign In for Pricing
View Details MBS6398289-02 5x 0.1 mL
VEGFR-1 (Vascular Endothelial Growth Factor Receptor 1, Fms-like Tyrosine Kinase 1, FLT-1, Tyrosine-protein Kinase FRT, Tyrosine-protein Kinase Receptor FLT, Vascular Permeability Factor Receptor, FLT1, FLT, FRT) (MaxLight 550)
Sign In for Pricing
View Details